PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015313
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 319aa    MW: 36477.4 Da    PI: 7.5674
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58681906PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.8e-3167120255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                prlrWtpeLH  Fv+ave+LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Lsa015313  67 PRLRWTPELHLIFVRAVERLGGQERATPKLVLQLMNMKGLSIAHVKSHLQMYRS 120
                8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.93863123IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2963121IPR009057Homeodomain-like
SuperFamilySSF466891.0E-1465121IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-2267122IPR006447Myb domain, plants
PfamPF002495.5E-1068119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MMEDGDCDCS DMNDHFCCRK LEDDDDDEGN KAKSSESSGN NSVVDQVEGE KMDASTRVRQ  60
YVRSKMPRLR WTPELHLIFV RAVERLGGQE RATPKLVLQL MNMKGLSIAH VKSHLQMYRS  120
KKIDDQGQVI NEGDHYYTGR NSHHVQSLWQ LPMFRPRLVR PNPIPSYGAS MADRGLVNGH  180
GSYCTNKILN SSMVEQDYKI AHHEMQQWVM KQALCNMTRS TLVDHQLVKS QRFDNPIETK  240
KRKAVDNGLD LNLSLSMKLR SREEEEDYAD EEVDSSLCLS LIPSSPKKEK LFRDPHGSSR  300
FSKCAKSPRL MASTLDLTI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278456.15e-56PREDICTED: uncharacterized protein LOC100246669
TrEMBLA0A103Y6Z61e-133A0A103Y6Z6_CYNCS; Homeodomain-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-47G2-like family protein